PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001565m
Common NameCARUB_v10001525mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 302aa    MW: 31898.2 Da    PI: 6.8042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001565mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29e-091155345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +W+ e+d  + +a +    +   +W++Ia+ ++ g++ +q+k+++ 
  Carubv10001565m 11 AWSREDDIAFERALASNTDEseeRWEKIAADVP-GKSVEQIKEHYE 55
                     7*****************99*************.**********95 PP

2Myb_DNA-binding422.2e-13119163347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Carubv10001565m 119 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 163
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.672762IPR017884SANT domain
SMARTSM007175.8E-8860IPR001005SANT/Myb domain
PfamPF002491.0E-71155IPR001005SANT/Myb domain
CDDcd001674.43E-81158No hitNo description
Gene3DG3DSA:1.10.10.602.1E-41154IPR009057Homeodomain-like
SuperFamilySSF466893.59E-91265IPR009057Homeodomain-like
PROSITE profilePS5129417.581111168IPR017930Myb domain
SuperFamilySSF466891.29E-16114169IPR009057Homeodomain-like
SMARTSM007173.2E-10116166IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.7E-17116166IPR006447Myb domain, plants
CDDcd001678.87E-10119164No hitNo description
PfamPF002492.8E-11119163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-10119162IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MTVEEVSDAS AWSREDDIAF ERALASNTDE SEERWEKIAA DVPGKSVEQI KEHYELLVED  60
VSRIESGCVP LPAYGSPEGS NGHAGDEGGS SKKGGNSHAG ESNQGGKSKS DQERRKGIAW  120
TEDEHRLFLL GLDKYGKGDW RSISRNFVVT RTPTQVASHA QKYFIRLNSM NKDRRRSSIH  180
DITSVGNADV STPQGPITGQ NNSTNNNNTS STVVAGGGNK SAKQAVSQPP PGPPMYGTPS  240
IGQPVGGPMV SAVGTPVNLP APPHIAYGVH AAPVPGSGVP GAPMNMGQIP YTLPRTPTAH  300
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1412801179RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529810.0AK352981.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-15-N01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288282.10.0hypothetical protein CARUB_v10001525mg
RefseqXP_006288283.10.0hypothetical protein CARUB_v10001525mg
SwissprotQ8S9H77e-60DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0FGS80.0R0FGS8_9BRAS; Uncharacterized protein
TrEMBLR0H8E30.0R0H8E3_9BRAS; Uncharacterized protein
STRINGAT5G08520.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-179MYB family protein